PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj4g3v0109410.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family NF-YB
Protein Properties Length: 164aa    MW: 18254.4 Da    PI: 5.7388
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj4g3v0109410.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB170.81.6e-5321116297
            NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 
                      re +r+lPianvsrimkk+lP+nakisk+aket+qec sefisf+t+easdkcq+ekrktingddl+wa++tlGfedyv++lk yl+kyr++eg
  Lj4g3v0109410.1  21 RELERLLPIANVSRIMKKALPGNAKISKEAKETMQECLSEFISFITAEASDKCQNEKRKTINGDDLVWAMTTLGFEDYVQALKGYLHKYRDMEG 114
                      7889****************************************************************************************** PP

            NF-YB  96 ek 97 
                      ek
  Lj4g3v0109410.1 115 EK 116
                      97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.108.6E-5118130IPR009072Histone-fold
SuperFamilySSF471136.37E-3924128IPR009072Histone-fold
PfamPF008081.5E-272690IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.3E-185472No hitNo description
PRINTSPR006151.3E-187391No hitNo description
PRINTSPR006151.3E-1892110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 164 aa     Download sequence    Send to blast
MAESDKEIGG KNELTSPNGC RELERLLPIA NVSRIMKKAL PGNAKISKEA KETMQECLSE  60
FISFITAEAS DKCQNEKRKT INGDDLVWAM TTLGFEDYVQ ALKGYLHKYR DMEGEKTNYS  120
FIGRQQQNQQ GDDDAVGSGV SMPSSSTSYH HQGVMYASGN VWKS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g92_B1e-4421111292Transcription factor HapC (Eurofung)
4g91_B1e-4421111292Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004486346.12e-64PREDICTED: nuclear transcription factor Y subunit B-3-like
SwissprotO233101e-58NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLA0A151SBC72e-64A0A151SBC7_CAJCA; Nuclear transcription factor Y subunit B-3
STRINGGLYMA09G01650.18e-63(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59134150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.13e-59nuclear factor Y, subunit B3